PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo15G0045700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 216aa    MW: 24512.8 Da    PI: 9.7834
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo15G0045700genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.4e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W +eEde+l+++v+ +G g+W++ +++ g++R++k+c++rw++yl
  Spipo15G0045700 15 RGTWMAEEDEILARYVRVHGEGNWRSLPKRAGLKRCGKSCRLRWLNYL 62
                     89********************************************97 PP

2Myb_DNA-binding52.31.3e-1668112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ +++E++l+v+++k+lG++ W++Ia +++ gRt++++k++w++ 
  Spipo15G0045700  68 RGNISEQEEDLIVRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTT 112
                      7899******************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-23665IPR009057Homeodomain-like
PROSITE profilePS5129416.1911062IPR017930Myb domain
SuperFamilySSF466892.45E-2813109IPR009057Homeodomain-like
SMARTSM007179.3E-131464IPR001005SANT/Myb domain
PfamPF002497.5E-161562IPR001005SANT/Myb domain
CDDcd001671.30E-91762No hitNo description
PROSITE profilePS5129424.23363117IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2366117IPR009057Homeodomain-like
SMARTSM007179.6E-1467115IPR001005SANT/Myb domain
PfamPF002491.1E-1468112IPR001005SANT/Myb domain
CDDcd001675.92E-1172113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
RMGRNPCCSE EGLNRGTWMA EEDEILARYV RVHGEGNWRS LPKRAGLKRC GKSCRLRWLN  60
YLRPNIKRGN ISEQEEDLIV RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN TTLWKKLQGR  120
PLRAPKRRKP LAETSSQLQA PAEPYESQLH LPSGDLQTPT SPSLSHTPKE STVEFVLAEA  180
DDVSQVGAAG RSNGCHWPVQ SVSEEAVRDR AALVDW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-251311725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122127RAPKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007024611.12e-70Duplicated homeodomain-like superfamily protein, putative
SwissprotQ388508e-63MYB5_ARATH; Transcription repressor MYB5
TrEMBLA0A061GCW52e-70A0A061GCW5_THECC; Duplicated homeodomain-like superfamily protein, putative
STRINGVIT_04s0008g01800.t013e-68(Vitis vinifera)
STRINGVIT_04s0008g01820.t013e-68(Vitis vinifera)
STRINGVIT_09s0002g01400.t015e-68(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.13e-60myb domain protein 5